Mw Aspirin

Se-Aspirin

C5667-10 10 mg
EUR 328.00
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents.

Se-Aspirin

C5667-5 5 mg
EUR 206.00
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents.

Se-Aspirin

C5667-50 50 mg
EUR 1181.00
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents.

Aspirin Aluminum

HY-B2175 100mg
EUR 119.00

Aspirin (Acetylsalicylic acid)

A4013-5.1 10 mM (in 1mL DMSO)
EUR 108.00
Description: Aspirin (Acetylsalicylic acid) is a potent and selective inhibitor of cyclooxygenase (COX) with a broad range of pharmacological activities including anti-inflammation and pain relief.

Aspirin (Acetylsalicylic acid)

A4013-50 50 mg
EUR 131.00
Description: Aspirin (Acetylsalicylic acid) is a potent and selective inhibitor of cyclooxygenase (COX) with a broad range of pharmacological activities including anti-inflammation and pain relief.

Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide)

DNP15-MW 100 ug
EUR 445.00

MW-150

HY-120111 10mM/1mL
EUR 492.00

Urokinase protein (Low MW)

30C-CP4014 3 KU
EUR 89.00
Description: Purified native Human Urokinase protein (Low MW)

mPEG-Biotinylated (MW: 5000)

PEG-BTN 1 mg
EUR 347.00

MW-150 dihydrochloride dihydrate

HY-120111B 10mg
EUR 681.00

Topoisomerase IIα MW Marker

TG2011-3 20 units
EUR 436.00

Lys-Lys-Lys (MW: 402.53)

SP-101947-10 10 mg
EUR 164.00

Lys-Lys-Dihydrochloride (MW: 347.28)

SP-101950-50 50 mg
EUR 164.00

Dextran Sulfate Sodium Salt, MW 8,000

D0800-025 25g
EUR 232.00

Dextran Sulfate Sodium Salt, MW 8,000

D0800-100 100g
EUR 516.00

Dextran Sulfate Sodium Salt, MW 8,000

D0800-101 1Kg
EUR 3088.00

Dextran Sulfate Sodium Salt, MW 500,000

D0811-010 10g
EUR 165.00

Dextran Sulfate Sodium Salt, MW 500,000

D0811-050 50g
EUR 228.00

Dextran Sulfate Sodium Salt, MW 500,000

D0811-100 100g
EUR 334.00

Dextran Sulfate Sodium Salt, MW 500,000

D0811-101 1Kg
EUR 2548.00

Methoxy PEG Maleimide linear (MW: 10,000)

PEG-10K 100 mg
EUR 225.00

Methoxy PEG Maleimide lbranched (MW: 40,000)

PEG-40K 100 mg
EUR 225.00

Methoxy PEG Maleimide linear (MW: 5,000)

PEG-5K 100 mg
EUR 225.00

Methoxy PEG Maleimide linear (MW: 20,000)

PEGM-20K 100 mg
EUR 225.00

Lys-Lys-Lys-Lys (MW: 530.73)

SP-101948-5 5 mg
EUR 164.00

Ac-Glutamine [Ac-Gln (MW: 188.18)]

SP-86674-5 5 mg
EUR 164.00

Cal-670™-Dextran Conjugate *MW 3,000*

20456 1 mg
EUR 480.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-670™-Dextran Conjugate *MW 10,000*

20457 1 mg
EUR 480.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-770™-Dextran Conjugate *MW 3,000*

20461 1 mg
EUR 480.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-770™-Dextran Conjugate *MW 10,000*

20462 1 mg
EUR 480.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-590™-Dextran Conjugate *MW 3,000*

20508 1 mg
EUR 306.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-590™-Dextran Conjugate *MW 10,000*

20509 1 mg
EUR 306.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-630™-Dextran Conjugate *MW 3,000*

20545 1 mg
EUR 50.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-630™-Dextran Conjugate *MW 10,000*

20546 1 mg
EUR 306.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-520®-Dextran Conjugate *MW 3,000*

20600 1 mg
EUR 219.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Cal-520®-Dextran Conjugate *MW 10,000*

20601 5 mg
EUR 306.00
  • R-phrase: R20, R21, R22
  • H-Phrase: H303, H313, H333
  • Symbol for dangerous compounds: Xn
  • UNSPEC Code: 12352200

Dextran sulfate sodium salt, MW approx. 500,000

GC2426-10G 10 g
EUR 130.00

Dextran sulfate sodium salt, MW approx. 500,000

GC2426-1G 1 g
EUR 50.00

Dextran sulfate sodium salt, MW approx. 500,000

GC2426-5G 5 g
EUR 86.00

Dextran sulfate sodium salt (MW 4500-5500)

HY-116282A 100mg
EUR 108.00

Dextran sulfate sodium salt (MW 16000-24000)

HY-116282B 100mg
EUR 108.00

Dextran sulfate sodium salt (MW 35000-45000)

HY-116282C 100mg
EUR 108.00

Dextran sulfate sodium salt (MW 450000-550000)

HY-116282D 100mg
EUR 108.00

Lys-Lys-Lys-Lys-Lys (MW: 658.73)

SP-101949-5 5 mg
EUR 164.00

Poly-L-Lysine hydrochloride (MW: >30 kda)

SP-101951-30 25 mg
EUR 141.00

?-Casomorphin (1-2) [Tyr-Pro (MW: 278.31)]

SP-55314-5 5 mg
EUR 164.00

Crystalline [H-Trp-Gly-OH; MW: 261.2]

SP-55342-1 1 mg
EUR 141.00

Kyotorphin [H-Tyr-Arg-OH; MW: 337.4]

SP-55344-5 5 mg
EUR 164.00

D-P (AA: Asp-Pro) (MW: 230.22)

SP-70110-5 5 mg
EUR 164.00

Y-A (AA: Tyr-Ala) (MW: 252.27)

SP-79062-5 5 mg
EUR 164.00

CF543-Dextran 10, 000 MW, anionic and fixable

80111 1MG
EUR 143.00
Description: Minimum order quantity: 1 unit of 1MG

CF555-Dextran 10, 000 MW, anionic and fixable

80112 1MG
EUR 143.00
Description: Minimum order quantity: 1 unit of 1MG

CF568-Dextran 10, 000 MW, anionic and fixable

80113 1MG
EUR 143.00
Description: Minimum order quantity: 1 unit of 1MG

CF594-Dextran 10, 000 MW, anionic and fixable

80114 1MG
EUR 143.00
Description: Minimum order quantity: 1 unit of 1MG

CF640R-Dextran 10, 000 MW, anionic and fixable

80115 1MG
EUR 143.00
Description: Minimum order quantity: 1 unit of 1MG

CF680R-Dextran 10, 000 MW, anionic and fixable

80116 1MG
EUR 143.00
Description: Minimum order quantity: 1 unit of 1MG

CF488A-Dextran 70, 000 MW, anionic and fixable

80117 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF680-Dextran 10, 000 MW, anionic and fixable

80118 1MG
EUR 150.00
Description: Minimum order quantity: 1 unit of 1MG

CF750-Dextran 10, 000 MW, anionic and fixable

80119 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF790-Dextran 10, 000 MW, anionic and fixable

80121 1MG
EUR 178.00
Description: Minimum order quantity: 1 unit of 1MG

CF770-Dextran 40, 000 MW, anionic and fixable

80122 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF770-Dextran 70, 000 MW, anionic and fixable

80123 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF770-Dextran 150, 000 MW, anionic and fixable

80124 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF488A-Dextran 40, 000 MW, anionic and fixable

80126 1MG
EUR 150.00
Description: Minimum order quantity: 1 unit of 1MG

CF680-Dextran 40, 000 MW, anionic and fixable

80127 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF750-Dextran 40, 000 MW, anionic and fixable

80128 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF680-Dextran 70, 000 MW, anionic and fixable

80129 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF488A-Dextran 150, 000 MW, anionic and fixable

80131 1MG
EUR 150.00
Description: Minimum order quantity: 1 unit of 1MG

CF680-Dextran 150, 000 MW, anionic and fixable

80132 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF750-Dextran 150, 000 MW, anionic and fixable

80133 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF488A-Dextran 250, 000 MW, anionic and fixable

80134 1MG
EUR 150.00
Description: Minimum order quantity: 1 unit of 1MG

CF680-Dextran 250, 000 MW, anionic and fixable

80135 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF750-Dextran 250, 000 MW, anionic and fixable

80136 1MG
EUR 166.00
Description: Minimum order quantity: 1 unit of 1MG

CF350-Dextran 3, 500 MW, anionic and fixable

80137 1MG
EUR 155.00
Description: Minimum order quantity: 1 unit of 1MG

Methoxy PEG Carboxy Acetic Acid (MW: 5000-linear)

PEG-05K-COH 100 mg
EUR 164.00

Poly-L-Lysine hydrochloride (MW: 15-30 kda)

SP-101951-25 25 mg
EUR 164.00

MGP-pNA [Met-Gly-Pro-pNA MW 447.54]

SP-52553-1 1 mg
EUR 141.00

Bursin [H-Lys-His-Gly-NH2; MW: 339.4]

SP-55178-5 5 mg
EUR 164.00

Anorexigenic Peptide [pGlu-His-Gly-OH; MW: 323.4]

SP-55353-1 1 mg
EUR 141.00

Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]

SP-55426-1 0.5 mg
EUR 663.00

?-Casomorphin (1-3) [Tyr-Pro-Phe (MW: 425.49)]

SP-59088-5 5 mg
EUR 164.00

A-H-A [Ala-His-Ala (MW: 297.32)]

SP-84987-5 5 mg
EUR 164.00

A-L-A [Ala-Leu-Ala (MW: 273.33)]

SP-84992-5 5 mg
EUR 164.00

A-F-A [Ala-Phe-Ala (MW: 307.35)]

SP-84995-5 5 mg
EUR 164.00

[D-Arg2]- Kyotorphin [Tyr-D-Arg; MW: 337.38]

SP-89061-5 5 mg
EUR 286.00

TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41)

SP-89773-5 5 mg
EUR 225.00

[Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38]

SP-89775-5 5 mg
EUR 225.00

[Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44]

SP-89776-5 5 mg
EUR 225.00

?-Endorphin (30-31) (human) [Gly-Glu (MW: 204.18)]

SP-89898-5 5 mg
EUR 164.00

Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade

D0801-025 25g
EUR 354.00

Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade

D0801-100 100g
EUR 928.00

Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade

D0801-500 500g
EUR 3898.00

Dextran Sulfate Sodium Salt, MW 40,000 - 50,000, Colitis Grade

D0802-010 10g
EUR 340.00

Dextran Sulfate Sodium Salt, MW 40,000 - 50,000, Colitis Grade

D0802-050 50g
EUR 1144.00