![]() Se-Aspirin |
|||
C5667-10 | ApexBio | 10 mg | EUR 328 |
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents. |
![]() Se-Aspirin |
|||
C5667-5 | ApexBio | 5 mg | EUR 206 |
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents. |
![]() Se-Aspirin |
|||
C5667-50 | ApexBio | 50 mg | EUR 1181 |
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents. |
![]() Aspirin (Acetylsalicylic acid) |
|||
A4013-5.1 | ApexBio | 10 mM (in 1mL DMSO) | EUR 108 |
Description: Aspirin (Acetylsalicylic acid) is a potent and selective inhibitor of cyclooxygenase (COX) with a broad range of pharmacological activities including anti-inflammation and pain relief. |
![]() Aspirin (Acetylsalicylic acid) |
|||
A4013-50 | ApexBio | 50 mg | EUR 131 |
Description: Aspirin (Acetylsalicylic acid) is a potent and selective inhibitor of cyclooxygenase (COX) with a broad range of pharmacological activities including anti-inflammation and pain relief. |
![]() Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide) |
|||
DNP15-MW | Alpha Diagnostics | 100 ug | EUR 445 |
![]() MW-150 |
|||
HY-120111 | MedChemExpress | 10mM/1mL | EUR 492 |
![]() Urokinase protein (Low MW) |
|||
30C-CP4014 | Fitzgerald | 3 KU | EUR 89 |
Description: Purified native Human Urokinase protein (Low MW) |
![]() MW-150 dihydrochloride dihydrate |
|||
HY-120111B | MedChemExpress | 10mg | EUR 681 |
![]() Topoisomerase IIα MW Marker |
|||
TG2011-3 | TopoGen | 20 units | EUR 436 |
![]() mPEG-Biotinylated (MW: 5000) |
|||
PEG-BTN | Alpha Diagnostics | 1 mg | EUR 347 |
![]() Lys-Lys-Lys (MW: 402.53) |
|||
SP-101947-10 | Alpha Diagnostics | 10 mg | EUR 164 |
![]() Lys-Lys-Dihydrochloride (MW: 347.28) |
|||
SP-101950-50 | Alpha Diagnostics | 50 mg | EUR 164 |
![]() Dextran Sulfate Sodium Salt, MW 8,000 |
|||
D0800-025 | GenDepot | 25g | EUR 232 |
![]() Dextran Sulfate Sodium Salt, MW 8,000 |
|||
D0800-100 | GenDepot | 100g | EUR 516 |
![]() Dextran Sulfate Sodium Salt, MW 8,000 |
|||
D0800-101 | GenDepot | 1Kg | EUR 3088 |
![]() Dextran Sulfate Sodium Salt, MW 500,000 |
|||
D0811-010 | GenDepot | 10g | EUR 165 |
![]() Dextran Sulfate Sodium Salt, MW 500,000 |
|||
D0811-050 | GenDepot | 50g | EUR 228 |
![]() Dextran Sulfate Sodium Salt, MW 500,000 |
|||
D0811-100 | GenDepot | 100g | EUR 334 |
![]() Dextran Sulfate Sodium Salt, MW 500,000 |
|||
D0811-101 | GenDepot | 1Kg | EUR 2548 |
![]() Methoxy PEG Maleimide linear (MW: 10,000) |
|||
PEG-10K | Alpha Diagnostics | 100 mg | EUR 225 |
![]() Methoxy PEG Maleimide lbranched (MW: 40,000) |
|||
PEG-40K | Alpha Diagnostics | 100 mg | EUR 225 |
![]() Methoxy PEG Maleimide linear (MW: 5,000) |
|||
PEG-5K | Alpha Diagnostics | 100 mg | EUR 225 |
![]() Methoxy PEG Maleimide linear (MW: 20,000) |
|||
PEGM-20K | Alpha Diagnostics | 100 mg | EUR 225 |
![]() Lys-Lys-Lys-Lys (MW: 530.73) |
|||
SP-101948-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Ac-Glutamine [Ac-Gln (MW: 188.18)] |
|||
SP-86674-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Cal-670™-Dextran Conjugate *MW 3,000* |
|||
20456 | AAT Bioquest | 1 mg | EUR 480 |
![]() Cal-670™-Dextran Conjugate *MW 10,000* |
|||
20457 | AAT Bioquest | 1 mg | EUR 480 |
![]() Cal-770™-Dextran Conjugate *MW 3,000* |
|||
20461 | AAT Bioquest | 1 mg | EUR 480 |
![]() Cal-770™-Dextran Conjugate *MW 10,000* |
|||
20462 | AAT Bioquest | 1 mg | EUR 480 |
![]() Cal-590™-Dextran Conjugate *MW 3,000* |
|||
20508 | AAT Bioquest | 1 mg | EUR 306 |
![]() Cal-590™-Dextran Conjugate *MW 10,000* |
|||
20509 | AAT Bioquest | 1 mg | EUR 306 |
![]() Cal-630™-Dextran Conjugate *MW 3,000* |
|||
20545 | AAT Bioquest | 1 mg | EUR 50 |
![]() Cal-630™-Dextran Conjugate *MW 10,000* |
|||
20546 | AAT Bioquest | 1 mg | EUR 306 |
![]() Cal-520®-Dextran Conjugate *MW 3,000* |
|||
20600 | AAT Bioquest | 1 mg | EUR 219 |
![]() Cal-520®-Dextran Conjugate *MW 10,000* |
|||
20601 | AAT Bioquest | 5 mg | EUR 306 |
![]() Dextran sulfate sodium salt (MW 4500-5500) |
|||
HY-116282A | MedChemExpress | 100mg | EUR 108 |
![]() Dextran sulfate sodium salt (MW 16000-24000) |
|||
HY-116282B | MedChemExpress | 100mg | EUR 108 |
![]() Dextran sulfate sodium salt (MW 35000-45000) |
|||
HY-116282C | MedChemExpress | 100mg | EUR 108 |
![]() Dextran sulfate sodium salt (MW 450000-550000) |
|||
HY-116282D | MedChemExpress | 100mg | EUR 108 |
![]() Dextran sulfate sodium salt, MW approx. 500,000 |
|||
GC2426-10G | Glentham Life Sciences | 10 g | EUR 130 |
![]() Dextran sulfate sodium salt, MW approx. 500,000 |
|||
GC2426-1G | Glentham Life Sciences | 1 g | EUR 50 |
![]() Dextran sulfate sodium salt, MW approx. 500,000 |
|||
GC2426-5G | Glentham Life Sciences | 5 g | EUR 86 |
![]() Lys-Lys-Lys-Lys-Lys (MW: 658.73) |
|||
SP-101949-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Poly-L-Lysine hydrochloride (MW: >30 kda) |
|||
SP-101951-30 | Alpha Diagnostics | 25 mg | EUR 141 |
![]() ?-Casomorphin (1-2) [Tyr-Pro (MW: 278.31)] |
|||
SP-55314-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Crystalline [H-Trp-Gly-OH; MW: 261.2] |
|||
SP-55342-1 | Alpha Diagnostics | 1 mg | EUR 141 |
![]() Kyotorphin [H-Tyr-Arg-OH; MW: 337.4] |
|||
SP-55344-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() D-P (AA: Asp-Pro) (MW: 230.22) |
|||
SP-70110-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Y-A (AA: Tyr-Ala) (MW: 252.27) |
|||
SP-79062-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() CF543-Dextran 10, 000 MW, anionic and fixable |
|||
80111 | Biotium | 1MG | EUR 143 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF555-Dextran 10, 000 MW, anionic and fixable |
|||
80112 | Biotium | 1MG | EUR 143 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF568-Dextran 10, 000 MW, anionic and fixable |
|||
80113 | Biotium | 1MG | EUR 143 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF594-Dextran 10, 000 MW, anionic and fixable |
|||
80114 | Biotium | 1MG | EUR 143 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF640R-Dextran 10, 000 MW, anionic and fixable |
|||
80115 | Biotium | 1MG | EUR 143 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF680R-Dextran 10, 000 MW, anionic and fixable |
|||
80116 | Biotium | 1MG | EUR 143 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF488A-Dextran 70, 000 MW, anionic and fixable |
|||
80117 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF680-Dextran 10, 000 MW, anionic and fixable |
|||
80118 | Biotium | 1MG | EUR 150 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF750-Dextran 10, 000 MW, anionic and fixable |
|||
80119 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF790-Dextran 10, 000 MW, anionic and fixable |
|||
80121 | Biotium | 1MG | EUR 178 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF770-Dextran 40, 000 MW, anionic and fixable |
|||
80122 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF770-Dextran 70, 000 MW, anionic and fixable |
|||
80123 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF770-Dextran 150, 000 MW, anionic and fixable |
|||
80124 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF488A-Dextran 40, 000 MW, anionic and fixable |
|||
80126 | Biotium | 1MG | EUR 150 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF680-Dextran 40, 000 MW, anionic and fixable |
|||
80127 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF750-Dextran 40, 000 MW, anionic and fixable |
|||
80128 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF680-Dextran 70, 000 MW, anionic and fixable |
|||
80129 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF488A-Dextran 150, 000 MW, anionic and fixable |
|||
80131 | Biotium | 1MG | EUR 150 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF680-Dextran 150, 000 MW, anionic and fixable |
|||
80132 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF750-Dextran 150, 000 MW, anionic and fixable |
|||
80133 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF488A-Dextran 250, 000 MW, anionic and fixable |
|||
80134 | Biotium | 1MG | EUR 150 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF680-Dextran 250, 000 MW, anionic and fixable |
|||
80135 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF750-Dextran 250, 000 MW, anionic and fixable |
|||
80136 | Biotium | 1MG | EUR 166 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() CF350-Dextran 3, 500 MW, anionic and fixable |
|||
80137 | Biotium | 1MG | EUR 155 |
Description: Minimum order quantity: 1 unit of 1MG |
![]() Methoxy PEG Carboxy Acetic Acid (MW: 5000-linear) |
|||
PEG-05K-COH | Alpha Diagnostics | 100 mg | EUR 164 |
![]() Poly-L-Lysine hydrochloride (MW: 15-30 kda) |
|||
SP-101951-25 | Alpha Diagnostics | 25 mg | EUR 164 |
![]() MGP-pNA [Met-Gly-Pro-pNA MW 447.54] |
|||
SP-52553-1 | Alpha Diagnostics | 1 mg | EUR 141 |
![]() Bursin [H-Lys-His-Gly-NH2; MW: 339.4] |
|||
SP-55178-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Anorexigenic Peptide [pGlu-His-Gly-OH; MW: 323.4] |
|||
SP-55353-1 | Alpha Diagnostics | 1 mg | EUR 141 |
![]() Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)] |
|||
SP-55426-1 | Alpha Diagnostics | 0.5 mg | EUR 663 |
![]() ?-Casomorphin (1-3) [Tyr-Pro-Phe (MW: 425.49)] |
|||
SP-59088-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() A-H-A [Ala-His-Ala (MW: 297.32)] |
|||
SP-84987-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() A-L-A [Ala-Leu-Ala (MW: 273.33)] |
|||
SP-84992-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() A-F-A [Ala-Phe-Ala (MW: 307.35)] |
|||
SP-84995-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() [D-Arg2]- Kyotorphin [Tyr-D-Arg; MW: 337.38] |
|||
SP-89061-5 | Alpha Diagnostics | 5 mg | EUR 286 |
![]() TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41) |
|||
SP-89773-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() [Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38] |
|||
SP-89775-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() [Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44] |
|||
SP-89776-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() ?-Endorphin (30-31) (human) [Gly-Glu (MW: 204.18)] |
|||
SP-89898-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Rhod-2 dextran conjugate *Low affinity with MW 3000* |
|||
20450 | AAT Bioquest | 1 mg | EUR 393 |
![]() Rhod-2 dextran conjugate *Low affinity with MW 10,000* |
|||
20451 | AAT Bioquest | 1 mg | EUR 393 |
![]() Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade |
|||
D0801-025 | GenDepot | 25g | EUR 354 |
![]() Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade |
|||
D0801-100 | GenDepot | 100g | EUR 928 |
![]() Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade |
|||
D0801-500 | GenDepot | 500g | EUR 3898 |
![]() Dextran Sulfate Sodium Salt, MW 40,000 - 50,000, Colitis Grade |
|||
D0802-010 | GenDepot | 10g | EUR 340 |