 Se-Aspirin |
|||
| C5667-10 | ApexBio | 10 mg | EUR 328.00 |
|
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents. |
|||
Se-Aspirin |
|||
| C5667-5 | ApexBio | 5 mg | EUR 206.00 |
|
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents. |
|||
Se-Aspirin |
|||
| C5667-50 | ApexBio | 50 mg | EUR 1181.00 |
|
Description: Se-Aspirin is a novel selenium-nonsteroidal anti-inflammatory drug (Se-NSAID) [1]. NSAIDs have demonstrated intestinal antineoplastic effects in various animal intestinal cancer models. Selenium (Se) compounds have attracted a vast interest as promising chemo-preventive agents. |
|||
 Aspirin Aluminum |
|||
| HY-B2175 | MEDCHEMEXPRESS | 100mg | EUR 119.00 |
) Aspirin (Acetylsalicylic acid) |
|||
| A4013-5.1 | ApexBio | 10 mM (in 1mL DMSO) | EUR 108.00 |
|
Description: Aspirin (Acetylsalicylic acid) is a potent and selective inhibitor of cyclooxygenase (COX) with a broad range of pharmacological activities including anti-inflammation and pain relief. |
|||
Aspirin (Acetylsalicylic acid) |
|||
| A4013-50 | ApexBio | 50 mg | EUR 131.00 |
|
Description: Aspirin (Acetylsalicylic acid) is a potent and selective inhibitor of cyclooxygenase (COX) with a broad range of pharmacological activities including anti-inflammation and pain relief. |
|||
 IgG1, aff pure (w/o azide)) Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide) |
|||
| DNP15-MW | Alpha Diagnostics | 100 ug | EUR 445.00 |
 MW-150 |
|||
| HY-120111 | MEDCHEMEXPRESS | 10mM/1mL | EUR 492.00 |
) Urokinase protein (Low MW) |
|||
| 30C-CP4014 | Fitzgerald | 3 KU | EUR 89.00 |
|
Description: Purified native Human Urokinase protein (Low MW) |
|||
) mPEG-Biotinylated (MW: 5000) |
|||
| PEG-BTN | Alpha Diagnostics | 1 mg | EUR 347.00 |
 MW-150 dihydrochloride dihydrate |
|||
| HY-120111B | MEDCHEMEXPRESS | 10mg | EUR 681.00 |
 Topoisomerase IIα MW Marker |
|||
| TG2011-3 | TopoGen | 20 units | EUR 436.00 |
) Lys-Lys-Lys (MW: 402.53) |
|||
| SP-101947-10 | Alpha Diagnostics | 10 mg | EUR 164.00 |
) Lys-Lys-Dihydrochloride (MW: 347.28) |
|||
| SP-101950-50 | Alpha Diagnostics | 50 mg | EUR 164.00 |
 Dextran Sulfate Sodium Salt, MW 8,000 |
|||
| D0800-025 | GenDepot | 25g | EUR 232.00 |
Dextran Sulfate Sodium Salt, MW 8,000 |
|||
| D0800-100 | GenDepot | 100g | EUR 516.00 |
Dextran Sulfate Sodium Salt, MW 8,000 |
|||
| D0800-101 | GenDepot | 1Kg | EUR 3088.00 |
 Dextran Sulfate Sodium Salt, MW 500,000 |
|||
| D0811-010 | GenDepot | 10g | EUR 165.00 |
Dextran Sulfate Sodium Salt, MW 500,000 |
|||
| D0811-050 | GenDepot | 50g | EUR 228.00 |
Dextran Sulfate Sodium Salt, MW 500,000 |
|||
| D0811-100 | GenDepot | 100g | EUR 334.00 |
Dextran Sulfate Sodium Salt, MW 500,000 |
|||
| D0811-101 | GenDepot | 1Kg | EUR 2548.00 |
) Methoxy PEG Maleimide linear (MW: 10,000) |
|||
| PEG-10K | Alpha Diagnostics | 100 mg | EUR 225.00 |
) Methoxy PEG Maleimide lbranched (MW: 40,000) |
|||
| PEG-40K | Alpha Diagnostics | 100 mg | EUR 225.00 |
) Methoxy PEG Maleimide linear (MW: 5,000) |
|||
| PEG-5K | Alpha Diagnostics | 100 mg | EUR 225.00 |
) Methoxy PEG Maleimide linear (MW: 20,000) |
|||
| PEGM-20K | Alpha Diagnostics | 100 mg | EUR 225.00 |
) Lys-Lys-Lys-Lys (MW: 530.73) |
|||
| SP-101948-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
]) Ac-Glutamine [Ac-Gln (MW: 188.18)] |
|||
| SP-86674-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 Cal-670™-Dextran Conjugate *MW 3,000* |
|||
| 20456 | AAT Bioquest | 1 mg | EUR 480.00 |
|
|||
 Cal-670™-Dextran Conjugate *MW 10,000* |
|||
| 20457 | AAT Bioquest | 1 mg | EUR 480.00 |
|
|||
 Cal-770™-Dextran Conjugate *MW 3,000* |
|||
| 20461 | AAT Bioquest | 1 mg | EUR 480.00 |
|
|||
 Cal-770™-Dextran Conjugate *MW 10,000* |
|||
| 20462 | AAT Bioquest | 1 mg | EUR 480.00 |
|
|||
 Cal-590™-Dextran Conjugate *MW 3,000* |
|||
| 20508 | AAT Bioquest | 1 mg | EUR 306.00 |
|
|||
 Cal-590™-Dextran Conjugate *MW 10,000* |
|||
| 20509 | AAT Bioquest | 1 mg | EUR 306.00 |
|
|||
 Cal-630™-Dextran Conjugate *MW 3,000* |
|||
| 20545 | AAT Bioquest | 1 mg | EUR 50.00 |
|
|||
 Cal-630™-Dextran Conjugate *MW 10,000* |
|||
| 20546 | AAT Bioquest | 1 mg | EUR 306.00 |
|
|||
 Cal-520®-Dextran Conjugate *MW 3,000* |
|||
| 20600 | AAT Bioquest | 1 mg | EUR 219.00 |
|
|||
 Cal-520®-Dextran Conjugate *MW 10,000* |
|||
| 20601 | AAT Bioquest | 5 mg | EUR 306.00 |
|
|||
 Dextran sulfate sodium salt, MW approx. 500,000 |
|||
| GC2426-10G | Glentham Life Sciences | 10 g | EUR 130.00 |
Dextran sulfate sodium salt, MW approx. 500,000 |
|||
| GC2426-1G | Glentham Life Sciences | 1 g | EUR 50.00 |
Dextran sulfate sodium salt, MW approx. 500,000 |
|||
| GC2426-5G | Glentham Life Sciences | 5 g | EUR 86.00 |
) Dextran sulfate sodium salt (MW 4500-5500) |
|||
| HY-116282A | MEDCHEMEXPRESS | 100mg | EUR 108.00 |
) Dextran sulfate sodium salt (MW 16000-24000) |
|||
| HY-116282B | MEDCHEMEXPRESS | 100mg | EUR 108.00 |
) Dextran sulfate sodium salt (MW 35000-45000) |
|||
| HY-116282C | MEDCHEMEXPRESS | 100mg | EUR 108.00 |
) Dextran sulfate sodium salt (MW 450000-550000) |
|||
| HY-116282D | MEDCHEMEXPRESS | 100mg | EUR 108.00 |
) Lys-Lys-Lys-Lys-Lys (MW: 658.73) |
|||
| SP-101949-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
) Poly-L-Lysine hydrochloride (MW: >30 kda) |
|||
| SP-101951-30 | Alpha Diagnostics | 25 mg | EUR 141.00 |
 [Tyr-Pro (MW: 278.31)]) ?-Casomorphin (1-2) [Tyr-Pro (MW: 278.31)] |
|||
| SP-55314-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 Crystalline [H-Trp-Gly-OH; MW: 261.2] |
|||
| SP-55342-1 | Alpha Diagnostics | 1 mg | EUR 141.00 |
 Kyotorphin [H-Tyr-Arg-OH; MW: 337.4] |
|||
| SP-55344-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 (MW: 230.22)) D-P (AA: Asp-Pro) (MW: 230.22) |
|||
| SP-70110-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 (MW: 252.27)) Y-A (AA: Tyr-Ala) (MW: 252.27) |
|||
| SP-79062-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 CF543-Dextran 10, 000 MW, anionic and fixable |
|||
| 80111 | Biotium | 1MG | EUR 143.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF555-Dextran 10, 000 MW, anionic and fixable |
|||
| 80112 | Biotium | 1MG | EUR 143.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF568-Dextran 10, 000 MW, anionic and fixable |
|||
| 80113 | Biotium | 1MG | EUR 143.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF594-Dextran 10, 000 MW, anionic and fixable |
|||
| 80114 | Biotium | 1MG | EUR 143.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF640R-Dextran 10, 000 MW, anionic and fixable |
|||
| 80115 | Biotium | 1MG | EUR 143.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF680R-Dextran 10, 000 MW, anionic and fixable |
|||
| 80116 | Biotium | 1MG | EUR 143.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF488A-Dextran 70, 000 MW, anionic and fixable |
|||
| 80117 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF680-Dextran 10, 000 MW, anionic and fixable |
|||
| 80118 | Biotium | 1MG | EUR 150.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF750-Dextran 10, 000 MW, anionic and fixable |
|||
| 80119 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF790-Dextran 10, 000 MW, anionic and fixable |
|||
| 80121 | Biotium | 1MG | EUR 178.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF770-Dextran 40, 000 MW, anionic and fixable |
|||
| 80122 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF770-Dextran 70, 000 MW, anionic and fixable |
|||
| 80123 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF770-Dextran 150, 000 MW, anionic and fixable |
|||
| 80124 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF488A-Dextran 40, 000 MW, anionic and fixable |
|||
| 80126 | Biotium | 1MG | EUR 150.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF680-Dextran 40, 000 MW, anionic and fixable |
|||
| 80127 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF750-Dextran 40, 000 MW, anionic and fixable |
|||
| 80128 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF680-Dextran 70, 000 MW, anionic and fixable |
|||
| 80129 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF488A-Dextran 150, 000 MW, anionic and fixable |
|||
| 80131 | Biotium | 1MG | EUR 150.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF680-Dextran 150, 000 MW, anionic and fixable |
|||
| 80132 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF750-Dextran 150, 000 MW, anionic and fixable |
|||
| 80133 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF488A-Dextran 250, 000 MW, anionic and fixable |
|||
| 80134 | Biotium | 1MG | EUR 150.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF680-Dextran 250, 000 MW, anionic and fixable |
|||
| 80135 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF750-Dextran 250, 000 MW, anionic and fixable |
|||
| 80136 | Biotium | 1MG | EUR 166.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
 CF350-Dextran 3, 500 MW, anionic and fixable |
|||
| 80137 | Biotium | 1MG | EUR 155.00 |
|
Description: Minimum order quantity: 1 unit of 1MG |
|||
) Methoxy PEG Carboxy Acetic Acid (MW: 5000-linear) |
|||
| PEG-05K-COH | Alpha Diagnostics | 100 mg | EUR 164.00 |
) Poly-L-Lysine hydrochloride (MW: 15-30 kda) |
|||
| SP-101951-25 | Alpha Diagnostics | 25 mg | EUR 164.00 |
 MGP-pNA [Met-Gly-Pro-pNA MW 447.54] |
|||
| SP-52553-1 | Alpha Diagnostics | 1 mg | EUR 141.00 |
 Bursin [H-Lys-His-Gly-NH2; MW: 339.4] |
|||
| SP-55178-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 Anorexigenic Peptide [pGlu-His-Gly-OH; MW: 323.4] |
|||
| SP-55353-1 | Alpha Diagnostics | 1 mg | EUR 141.00 |
, Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]) Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)] |
|||
| SP-55426-1 | Alpha Diagnostics | 0.5 mg | EUR 663.00 |
 [Tyr-Pro-Phe (MW: 425.49)]) ?-Casomorphin (1-3) [Tyr-Pro-Phe (MW: 425.49)] |
|||
| SP-59088-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
]) A-H-A [Ala-His-Ala (MW: 297.32)] |
|||
| SP-84987-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
]) A-L-A [Ala-Leu-Ala (MW: 273.33)] |
|||
| SP-84992-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
]) A-F-A [Ala-Phe-Ala (MW: 307.35)] |
|||
| SP-84995-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 [D-Arg2]- Kyotorphin [Tyr-D-Arg; MW: 337.38] |
|||
| SP-89061-5 | Alpha Diagnostics | 5 mg | EUR 286.00 |
 (MW: 362.41)) TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41) |
|||
| SP-89773-5 | Alpha Diagnostics | 5 mg | EUR 225.00 |
 [Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38] |
|||
| SP-89775-5 | Alpha Diagnostics | 5 mg | EUR 225.00 |
 [Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44] |
|||
| SP-89776-5 | Alpha Diagnostics | 5 mg | EUR 225.00 |
 (human) [Gly-Glu (MW: 204.18)]) ?-Endorphin (30-31) (human) [Gly-Glu (MW: 204.18)] |
|||
| SP-89898-5 | Alpha Diagnostics | 5 mg | EUR 164.00 |
 Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade |
|||
| D0801-025 | GenDepot | 25g | EUR 354.00 |
Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade |
|||
| D0801-100 | GenDepot | 100g | EUR 928.00 |
Dextran Sulfate Sodium Salt, MW 35,000 - 50,000, Colitis Grade |
|||
| D0801-500 | GenDepot | 500g | EUR 3898.00 |
 Dextran Sulfate Sodium Salt, MW 40,000 - 50,000, Colitis Grade |
|||
| D0802-010 | GenDepot | 10g | EUR 340.00 |
Dextran Sulfate Sodium Salt, MW 40,000 - 50,000, Colitis Grade |
|||
| D0802-050 | GenDepot | 50g | EUR 1144.00 |